- Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-87578
- Muscarinic Acetylcholine Receptor M5/CHRM5
- PBS (pH 7.2) and 40% Glycerol
- HM5
- Human
- 0.1 ml (also 25ul)
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Rabbit
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: AHRPKSQKCV AYKFRLVVKA DGNQETNNGC HKVKIMPCPF PVAKEPSTKG LNPNPSHQMT KRK
- cholinergic receptor muscarinic 5
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- GPCR, Neuroscience
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
AHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRK
Specifications/Features
Available conjugates: Unconjugated